Cela2a, Recombinant, Mouse, aa31-271, His-Tag (Chymotrypsin-like Elastase Family Member 2A)

Product Overview

• Article Name: Cela2a, Recombinant, Mouse, aa31-271, His-Tag (Chymotrypsin-like Elastase Family Member 2A)
• Biozol Catalog Number: USB-372716
• Supplier Catalog Number: 372716
• Alternative Catalog Number: USB-372716-20, USB-372716-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Acts upon elastin. Recombinant protein corresponding to aa31-271 from mouse Cela2a, fused to 6X His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.7kD Amino Acid Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 29.7
• UniProt: P05208
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.