Cellular Retinoic Acid-binding Protein 1, Recombinant, Human, aa2-137, GST-Tag (CRABP1)
Biozol Catalog Number:
USB-372719
Supplier Catalog Number:
372719
Alternative Catalog Number:
USB-372719-20,USB-372719-100,USB-372719-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors. Source: Recombinant protein corresponding to aa2-137 from human Cellular Retinoic Acid-binding Protein 1 fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~42.5kD Amino Acid Sequence: PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted