CEMP1, Recombinant, Human, aa1-247, His-Tag (Cementoblastoma-derived Protein 1)

Catalog Number: USB-372720
Article Name: CEMP1, Recombinant, Human, aa1-247, His-Tag (Cementoblastoma-derived Protein 1)
Biozol Catalog Number: USB-372720
Supplier Catalog Number: 372720
Alternative Catalog Number: USB-372720-20,USB-372720-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-247 from human CEMP1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.0kD Amino Acid Sequence: MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28
UniProt: Q6PRD7
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.