Cenpa, Recombinant, Mouse, aa1-134, His-Tag (Histone H3-like Centromeric Protein A)

Catalog Number: USB-372721
Article Name: Cenpa, Recombinant, Mouse, aa1-134, His-Tag (Histone H3-like Centromeric Protein A)
Biozol Catalog Number: USB-372721
Supplier Catalog Number: 372721
Alternative Catalog Number: USB-372721-20,USB-372721-100
Manufacturer: US Biological
Category: Molekularbiologie
Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assembly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. The CENPA-H4 heterotetramer can bind DNA by itself (in vitro). Source: Recombinant protein corresponding to aa1-134 from mouse Cenpa, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.51kD Amino Acid Sequence: MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.51
UniProt: O35216
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.