CENPH, Recombinant, Human, aa1-247, GST-Tag (Centromere Protein H)

Product Overview

• Article Name: CENPH, Recombinant, Human, aa1-247, GST-Tag (Centromere Protein H)
• Biozol Catalog Number: USB-372722
• Supplier Catalog Number: 372722
• Alternative Catalog Number: USB-372722-20,USB-372722-100,USB-372722-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate. Source: Recombinant protein corresponding to aa1-247 from human CENPH, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.5kD Amino Acid Sequence: MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 55.5
• UniProt: Q9H3R5
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.