Cerato-ulmin, Recombinant, Ophiostoma Ulmi, aa26-100, His-Tag (CU, Dutch Elm Disease Toxin)

Catalog Number: USB-372726
Article Name: Cerato-ulmin, Recombinant, Ophiostoma Ulmi, aa26-100, His-Tag (CU, Dutch Elm Disease Toxin)
Biozol Catalog Number: USB-372726
Supplier Catalog Number: 372726
Alternative Catalog Number: USB-372726-20,USB-372726-100
Manufacturer: US Biological
Category: Molekularbiologie
Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss. Source: Recombinant protein corresponding to aa26-100 from ophiostoma ulmi Cerato-ulmin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.6kD Amino Acid Sequence: SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 9.6
UniProt: Q06153
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.