Chaperone Protein DnaK, Recombinant, Mycoplasma Pneumoniae, aa426-595, His-SUMO-Tag (DnaK)

Catalog Number: USB-372738
Article Name: Chaperone Protein DnaK, Recombinant, Mycoplasma Pneumoniae, aa426-595, His-SUMO-Tag (DnaK)
Biozol Catalog Number: USB-372738
Supplier Catalog Number: 372738
Alternative Catalog Number: USB-372738-20,USB-372738-100
Manufacturer: US Biological
Category: Molekularbiologie
Acts as a chaperone. Source: Recombinant protein corresponding to aa426-595 from mycoplasma pneumoniae Chaperone Protein DnaK, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.5kD Amino Acid Sequence: QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.5
UniProt: P75344
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.