CHD4, Recombinant, Human, aa1-219, His-Tag (Chromodomain-helicase-DNA-binding Protein 4)
Biozol Catalog Number:
USB-372743
Supplier Catalog Number:
372743
Alternative Catalog Number:
USB-372743-20,USB-372743-100,USB-372743-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Source: Recombinant protein corresponding to aa1-219 from human CHD4, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~28.9kD Amino Acid Sequence: MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted