CID, Recombinant, Human, aa1-135, GST-Tag (Nuclear Nucleic Acid-binding Protein C1D)

Product Overview

• Article Name: CID, Recombinant, Human, aa1-135, GST-Tag (Nuclear Nucleic Acid-binding Protein C1D)
• Biozol Catalog Number: USB-372774
• Supplier Catalog Number: 372774
• Alternative Catalog Number: USB-372774-20,USB-372774-100,USB-372774-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3-5 end processing of the 5.8S rRNA, this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB. Source: Recombinant protein corresponding to aa1-135 from human C1D, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.4kD Amino Acid Sequence: MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 42.4
• UniProt: Q13901
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.