Citrate Synthase, Mitochondrial, Recombinant, Human, aa28-464, His-Tag (CS)

Catalog Number: USB-372778
Article Name: Citrate Synthase, Mitochondrial, Recombinant, Human, aa28-464, His-Tag (CS)
Biozol Catalog Number: USB-372778
Supplier Catalog Number: 372778
Alternative Catalog Number: USB-372778-20,USB-372778-100,USB-372778-1
Manufacturer: US Biological
Category: Molekularbiologie
Partial recombinant protein corresponding to aa28-464 from human Citrate Synthase Mitochondrial, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: O75390. Molecular Weight: ~52.9kD Amino Acid Sequence: ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 52.9
UniProt: O75390
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol