CLEC4D, Recombinant, Human, aa39-215, His-SUMO-Tag (C-type Lectin Domain Family 4 Member D)
Biozol Catalog Number:
USB-372784
Supplier Catalog Number:
372784
Alternative Catalog Number:
USB-372784-20,USB-372784-100,USB-372784-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells. Source: Recombinant protein corresponding to aa39-215 from human CLEC4D, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.7kD Amino Acid Sequence: CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted