Clumping Factor A, Recombinant, Staphylococcus Aureus, aa229-559, His-Tag (ClfA, Fibrinogen Receptor A, Fibrinogen-binding Protein A)

Product Overview

• Article Name: Clumping Factor A, Recombinant, Staphylococcus Aureus, aa229-559, His-Tag (ClfA, Fibrinogen Receptor A, Fibrinogen-binding Protein A)
• Biozol Catalog Number: USB-372785
• Supplier Catalog Number: 372785
• Alternative Catalog Number: USB-372785-20,USB-372785-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity). Source: Partial recombinant protein corresponding to aa229-559 from staphylococcus aureus ClfA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~38.0kD Amino Acid Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38
• UniProt: Q5HHM8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.