CLTA, Recombinant, Human, aa1-218, GST-Tag (Clathrin Light Chain A)

Product Overview

• Article Name: CLTA, Recombinant, Human, aa1-218, GST-Tag (Clathrin Light Chain A)
• Biozol Catalog Number: USB-372791
• Supplier Catalog Number: 372791
• Alternative Catalog Number: USB-372791-20,USB-372791-100,USB-372791-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge. Source: Recombinant protein corresponding to aa1-218 from human CLTA, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~50.7kD Amino Acid Sequence: MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 50.7
• UniProt: P09496
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.