CLTCL1, Recombinant, Human, aa1423-1566, His-Tag (Clathrin Heavy Chain 2)
Biozol Catalog Number:
USB-372793
Supplier Catalog Number:
372793
Alternative Catalog Number:
USB-372793-20,USB-372793-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network. Source: Recombinant protein corresponding to aa1423-1566 from human CLTCL1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.8kD Amino Acid Sequence: LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted