Product Description
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular domain matrix degradation, and regulation of gland secretion. Source: Recombinant protein corresponding to aa22-247 from macaca fascucularis CMA1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Appearance: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 50% glycerol. Purity: 90% (SDS-PAGE) Molecular Weight: ~41.1kD Amino Acid Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
* VAT and shipping costs not included. Errors and price changes excepted
