CMA1, Recombinant, Macaca Fascicularis, aa22-247, His-SUMO-Tag (Chymase)

Catalog Number: USB-372800
Article Name: CMA1, Recombinant, Macaca Fascicularis, aa22-247, His-SUMO-Tag (Chymase)
Biozol Catalog Number: USB-372800
Supplier Catalog Number: 372800
Alternative Catalog Number: USB-372800-20,USB-372800-100
Manufacturer: US Biological
Category: Molekularbiologie
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular domain matrix degradation, and regulation of gland secretion. Source: Recombinant protein corresponding to aa22-247 from macaca fascucularis CMA1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Appearance: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 50% glycerol. Purity: 90% (SDS-PAGE) Molecular Weight: ~41.1kD Amino Acid Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.1
UniProt: P56435
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.