CNKSR2, Recombinant, Human, aa650-800, His-Tag (Connector Enhancer of Kinase Suppressor of Ras 2)

Product Overview

• Article Name: CNKSR2, Recombinant, Human, aa650-800, His-Tag (Connector Enhancer of Kinase Suppressor of Ras 2)
• Biozol Catalog Number: USB-372805
• Supplier Catalog Number: 372805
• Alternative Catalog Number: USB-372805-20,USB-372805-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May function as an adapter protein or regulator of Ras signaling pathways. Source: Recombinant protein corresponding to aa650-800 from human CNKSR2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.1kD Amino Acid Sequence: AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 19.1
• UniProt: Q8WXI2
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.