CNN2, Recombinant, Human, aa2-309, His-SUMO-Tag (Calponin-2)

Catalog Number: USB-372806
Article Name: CNN2, Recombinant, Human, aa2-309, His-SUMO-Tag (Calponin-2)
Biozol Catalog Number: USB-372806
Supplier Catalog Number: 372806
Alternative Catalog Number: USB-372806-20,USB-372806-100,USB-372806-1
Manufacturer: US Biological
Category: Molekularbiologie
Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity. Source: Recombinant protein corresponding to aa2-309 from human CNN2, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~49.6kD Amino Acid Sequence: SSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 49.6
UniProt: Q99439
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.