COA1, Recombinant, Human, aa38-146, GST-Tag (Cytochrome C Oxidase Assembly Protein 1 Homolog)

Catalog Number: USB-372811
Article Name: COA1, Recombinant, Human, aa38-146, GST-Tag (Cytochrome C Oxidase Assembly Protein 1 Homolog)
Biozol Catalog Number: USB-372811
Supplier Catalog Number: 372811
Alternative Catalog Number: USB-372811-20,USB-372811-100,USB-372811-1
Manufacturer: US Biological
Category: Molekularbiologie
Component of some MITRAC complex, a cytochrome c oxidase (COX) assembly intermediate complex that regulates COX assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for assembly of mitochondrial respiratory chain complex I and complex IV. Recombinant protein corresponding to aa38-146 from human COA1, fused to GST-Tag at N-terminal, expressed in E coli. Molecular Weight: ~39.8kD Amino Acid Sequence: QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.8
UniProt: Q9GZY4
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.