Coagulation Factor XI, Recombinant, Human, aa19-387, His-Tag (F11)

Catalog Number: USB-372814
Article Name: Coagulation Factor XI, Recombinant, Human, aa19-387, His-Tag (F11)
Biozol Catalog Number: USB-372814
Supplier Catalog Number: 372814
Alternative Catalog Number: USB-372814-20,USB-372814-100
Manufacturer: US Biological
Category: Molekularbiologie
Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX. Source: Partial recombinant protein corresponding to aa19-387 from human Coagulation Factor XI, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.2kD Amino Acid Sequence: ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 45.2
UniProt: P03951
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.