COL18A1, Recombinant, Human, aa1578-1754, GST-Tag (Collagen alpha-1(XVIII) Chain)

Catalog Number: USB-372823
Article Name: COL18A1, Recombinant, Human, aa1578-1754, GST-Tag (Collagen alpha-1(XVIII) Chain)
Biozol Catalog Number: USB-372823
Supplier Catalog Number: 372823
Alternative Catalog Number: USB-372823-20,USB-372823-100,USB-372823-1
Manufacturer: US Biological
Category: Molekularbiologie
COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube. Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. Source: Partial recombinant protein corresponding to aa1578-1754 from human COL18A1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.3kD Amino Acid Sequence: QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 46.3
UniProt: P39060
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.