COMMD4, Recombinant, Human, aa1-195, GST-Tag (COMM Domain-containing Protein 4)

Catalog Number: USB-372834
Article Name: COMMD4, Recombinant, Human, aa1-195, GST-Tag (COMM Domain-containing Protein 4)
Biozol Catalog Number: USB-372834
Supplier Catalog Number: 372834
Alternative Catalog Number: USB-372834-20,USB-372834-100,USB-372834-1
Manufacturer: US Biological
Category: Molekularbiologie
May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. Down-regulates activation of NF-kappa-B. Recombinant protein corresponding to aa1-195 from human COMMD4, fused to GST-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: Q9H0A8 Molecular Weight: ~48.4kD Amino Acid Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 48.4
UniProt: Q9H0A8
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol