CreN7, Recombinant, Sulfolobus Islandicus, aa1-60, GST-Tag (Chromatin Protein Cren7)

Product Overview

• Article Name: CreN7, Recombinant, Sulfolobus Islandicus, aa1-60, GST-Tag (Chromatin Protein Cren7)
• Biozol Catalog Number: USB-372864
• Supplier Catalog Number: 372864
• Alternative Catalog Number: USB-372864-20,USB-372864-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils. Source: Recombinant protein corresponding to aa1-60 from sulfolobus islandicus CreN7, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.6kD Amino Acid Sequence: MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 33.6
• UniProt: C3MPN0
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.