CRIP1, Recombinant, Human, aa1-77, GST-Tag (Cysteine-rich Protein 1)

Product Overview

• Article Name: CRIP1, Recombinant, Human, aa1-77, GST-Tag (Cysteine-rich Protein 1)
• Biozol Catalog Number: USB-372866
• Supplier Catalog Number: 372866
• Alternative Catalog Number: USB-372866-20,USB-372866-100,USB-372866-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Source: Recombinant protein corresponding to aa1-77 from human CRIP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD Amino Acid Sequence: PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 35.4
• UniProt: P50238
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.