CRYAB, Recombinant, Human, aa1-175, His-SUMO-Tag (Alpha-crystallin B Chain)
Biozol Catalog Number:
USB-372872
Supplier Catalog Number:
372872
Alternative Catalog Number:
USB-372872-20,USB-372872-100,USB-372872-1
Manufacturer:
US Biological
Category:
Molekularbiologie
May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. Full length recombinant protein corresponding to aa1-175 from human Alpha-crystallin B Chain fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accession: P02511 Molecular Weight: ~36.2kD Amino Acid Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK Biological Activity: Not tested. This product is recommended for use only in applications that do not require the presence of biologically active form of the protein. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
