CSNK2B, Recombinant, Human, aa2-215, GST-Tag (Casein Kinase II Subunit beta)

Product Overview

• Article Name: CSNK2B, Recombinant, Human, aa2-215, GST-Tag (Casein Kinase II Subunit beta)
• Biozol Catalog Number: USB-372891
• Supplier Catalog Number: 372891
• Alternative Catalog Number: USB-372891-20,USB-372891-100,USB-372891-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Participates in Wnt signaling (By similarity). Plays a complex role in regulating the basal catalytic activity of the alpha subunit. Source: Recombinant protein corresponding to aa2-215 from human CSNK2B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.8kD Amino Acid Sequence: SSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 51.8
• UniProt: P67870
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.