CSRP2, Recombinant, Human, aa2-193, His-Tag (Cysteine and Glycine-rich Protein 2)

Product Overview

• Article Name: CSRP2, Recombinant, Human, aa2-193, His-Tag (Cysteine and Glycine-rich Protein 2)
• Biozol Catalog Number: USB-372892
• Supplier Catalog Number: 372892
• Alternative Catalog Number: USB-372892-20,USB-372892-100,USB-372892-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system Source: Recombinant protein corresponding to aa2-193 from human CSRP2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.8kD Amino Acid Sequence: PVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 24.8
• UniProt: Q16527
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.