CSTB, Recombinant, Human, aa1-98, GST-Tag (Cystatin-B)

Catalog Number: USB-372895
Article Name: CSTB, Recombinant, Human, aa1-98, GST-Tag (Cystatin-B)
Biozol Catalog Number: USB-372895
Supplier Catalog Number: 372895
Alternative Catalog Number: USB-372895-20,USB-372895-100,USB-372895-1
Manufacturer: US Biological
Category: Molekularbiologie
This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. Source: Recombinant full length protein corresponding to aa1-98 from human CSTB, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.1kD Amino Acid Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.1
UniProt: P04080
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.