CXCL13, Recombinant, Rat, aa23-108, GST-Tag (C-X-C Motif Chemokine 13 Protein)

Catalog Number: USB-372926
Article Name: CXCL13, Recombinant, Rat, aa23-108, GST-Tag (C-X-C Motif Chemokine 13 Protein)
Biozol Catalog Number: USB-372926
Supplier Catalog Number: 372926
Alternative Catalog Number: USB-372926-20,USB-372926-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa23-108 from rat CXCL13, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.8kD Amino Acid Sequence: LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36.8
UniProt: Q5I0J6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.