Cxcl16, Recombinant, Mouse, aa27-198, His-Tag (C-X-C Motif Chemokine 16)

Catalog Number: USB-372928
Article Name: Cxcl16, Recombinant, Mouse, aa27-198, His-Tag (C-X-C Motif Chemokine 16)
Biozol Catalog Number: USB-372928
Supplier Catalog Number: 372928
Alternative Catalog Number: USB-372928-20,USB-372928-100
Manufacturer: US Biological
Category: Molekularbiologie
Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. Source: Recombinant protein corresponding to aa27-198 from mouse C-X-C Motif Chemokine 16, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.7kD Amino Acid Sequence: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.7
UniProt: Q8BSU2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.