D-lactate Dehydrogenase, Recombinant, Leuconostoc Mesenteroides Subsp. Cremoris, aa1-331, His-Tag

Catalog Number: USB-372977
Article Name: D-lactate Dehydrogenase, Recombinant, Leuconostoc Mesenteroides Subsp. Cremoris, aa1-331, His-Tag
Biozol Catalog Number: USB-372977
Supplier Catalog Number: 372977
Alternative Catalog Number: USB-372977-20,USB-372977-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-331 from leuconostoc mesenteroides subsp. cremoris D-lactate Dehydrogenase, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.4kD Amino Acid Sequence: MKIFAYGIRDDEKPSLEEWKAANPEIEVDYTQELLTPETAKLAEGSDSAVVYQQLDYTRETLTALANVGVTNLSLRNVGTDNIDFDAAREFNFNISNVPVYSPNAIAEHSMLQLSRLLRRTKALDAKIAKRDLRWAPTTGREMRMQTVGVIGTGHIGRVAINILKGFGAKVIAYDKYPNAELQAEGLYVDTLDELYAQADAISLYVPGVPENHHLINADAIAKMKDGVVIMNAARGNLMDIDAIIDGLNSGKISDFGMDVYENEVACSMKIGLVKNSPDAKIADLIARENVMITPHTAFYTTKAVLEMVHQSFDAAVAFAKGEKPAIAVEY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.4
UniProt: P51011
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.