DapA, Recombinant, E. coli, aa1-292, His-Tag (Dihydrodipicolinate Synthase)

Catalog Number: USB-372987
Article Name: DapA, Recombinant, E. coli, aa1-292, His-Tag (Dihydrodipicolinate Synthase)
Biozol Catalog Number: USB-372987
Supplier Catalog Number: 372987
Alternative Catalog Number: USB-372987-20,USB-372987-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the condensation of (S)-aspartate-beta-sialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). Source: Recombinant protein corresponding to aa1-292 from E. coli DapA, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD Amino Acid Sequence: MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.4
UniProt: P0A6L2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.