DCAF4, Recombinant, Human, aa1-495, His-SUMO-Tag (DDB1- and CUL4-associated Factor 4)

Product Overview

• Article Name: DCAF4, Recombinant, Human, aa1-495, His-SUMO-Tag (DDB1- and CUL4-associated Factor 4)
• Biozol Catalog Number: USB-372992
• Supplier Catalog Number: 372992
• Alternative Catalog Number: USB-372992-20,USB-372992-100,USB-372992-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. Source: Recombinant protein corresponding to aa1-495 from human DCAF4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~71.7kD Amino Acid Sequence: MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 71.7
• UniProt: Q8WV16
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.