DCN, Recombinant, Human, aa20-359, His-Tag (Decorin)

Catalog Number: USB-372995
Article Name: DCN, Recombinant, Human, aa20-359, His-Tag (Decorin)
Biozol Catalog Number: USB-372995
Supplier Catalog Number: 372995
Alternative Catalog Number: USB-372995-20,USB-372995-100,USB-372995-1
Manufacturer: US Biological
Category: Molekularbiologie
May affect the rate of fibrils formation. Source: Recombinant protein corresponding to aa20-359 from human DCN, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.7kD Amino Acid Sequence: QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.7
UniProt: P07585
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.