DCP2, Recombinant, Human, aa1-385, His-Tag (mRNA-decapping Enzyme 2)

Catalog Number: USB-373001
Article Name: DCP2, Recombinant, Human, aa1-385, His-Tag (mRNA-decapping Enzyme 2)
Biozol Catalog Number: USB-373001
Supplier Catalog Number: 373001
Alternative Catalog Number: USB-373001-20,USB-373001-100,USB-373001-1
Manufacturer: US Biological
Category: Molekularbiologie
Decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. Roves the 7-methyl guanine cap structure from mRNA molecules, yielding a 5-phosphorylated mRNA fragment and 7m-GDP. Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety. Recombinant protein corresponding to aa1-385 from human DCP2, fused to a 6X His-Tag at N-terminal, expressed in Yeast. Uniprot/Accession: Q8IU60 Molecular Weight: ~46.4kD Amino Acid Sequence: METKRVEIPGSVLDDFCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 46.4
UniProt: Q8IU60
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from PBS, pH 7.4, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.