Has bactericidal activity. Recombinant protein corresponding to aa23-63 from mouse Defb4, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P82019 . Molecular Weight: ~20.6kD Amino Acid Sequence: QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
