DegP, Recombinant, E. coli, aa27-474, His-Tag (Periplasmic Serine Endoprotease DegP)

Catalog Number: USB-373034
Article Name: DegP, Recombinant, E. coli, aa27-474, His-Tag (Periplasmic Serine Endoprotease DegP)
Biozol Catalog Number: USB-373034
Supplier Catalog Number: 373034
Alternative Catalog Number: USB-373034-20,USB-373034-100
Manufacturer: US Biological
Category: Molekularbiologie
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions. DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP). Full-length recombinant protein corresponding to aa27-474 from E. coli mature DegP, fused to 6X His-Tag at N-terminal, expressed in Yeast. Uniprot/Accession: P0C0V0. Molecular Weight: ~48.8kD Amino Acid Sequence: AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 48.8
UniProt: P0C0V0
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 50% glycerol.