DENR, Recombinant, Human, aa2-198, His-SUMO-Tag (Density-regulated Protein, Protein DRP1, Smooth Muscle Cell-associated Protein 3, SMAP-3)
Biozol Catalog Number:
USB-373036
Supplier Catalog Number:
373036
Alternative Catalog Number:
USB-373036-20,USB-373036-100,USB-373036-1
Manufacturer:
US Biological
Category:
Molekularbiologie
May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation, promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1. Source: Recombinant protein corresponding to aa2-198 from human DENR, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38kD Amino Acid Sequence: AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted