DERF2, Recombinant, Dermatophagoides farinae, aa18-146, His-SUMO-Tag (Mite Group 2 Allergen Der f 2)

Catalog Number: USB-373037
Article Name: DERF2, Recombinant, Dermatophagoides farinae, aa18-146, His-SUMO-Tag (Mite Group 2 Allergen Der f 2)
Biozol Catalog Number: USB-373037
Supplier Catalog Number: 373037
Alternative Catalog Number: USB-373037-20,USB-373037-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa18-146 from dermatophagoides farinae DERF2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.1kD Amino Acid Sequence: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.1
UniProt: Q00855
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.