DHDH, Recombinant, Human, aa1-334, GST-Tag (Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)

Catalog Number: USB-373050
Article Name: DHDH, Recombinant, Human, aa1-334, GST-Tag (Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)
Biozol Catalog Number: USB-373050
Supplier Catalog Number: 373050
Alternative Catalog Number: USB-373050-20,USB-373050-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-334 from human DHDH, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~63.4kD Amino Acid Sequence: MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 63.4
UniProt: Q9UQ10
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.