Dio2, Recombinant, Rat, aa1-266, His-Tag (Type II Iodothyronine Deiodinase)
Biozol Catalog Number:
USB-373056
Supplier Catalog Number:
373056
Alternative Catalog Number:
USB-373056-20,USB-373056-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Catalyzes the deiodination of T4 (3,5,3,5-tetraiodothyronine) into T3 (3,5,3-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development. Source: Recombinant protein corresponding to aa1-266 from rat Dio2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~31.8kD Amino Acid Sequence: MGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted