Dio3, Recombinant, Rat, aa37-278, His-Tag (Type III Iodothyronine Deiodinase)

Catalog Number: USB-373058
Article Name: Dio3, Recombinant, Rat, aa37-278, His-Tag (Type III Iodothyronine Deiodinase)
Biozol Catalog Number: USB-373058
Supplier Catalog Number: 373058
Alternative Catalog Number: USB-373058-20,USB-373058-100
Manufacturer: US Biological
Category: Molekularbiologie
Responsible for the deiodination of T4 (3,5,3,5-tetraiodothyronine) into RT3 (3,3,5-triiodothyronine) and of T3 (3,5,3-triiodothyronine) into T2 (3,3-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during bryological development. Source: Recombinant protein corresponding to aa37-278 from rat Dio3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.5kD Amino Acid Sequence: DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.5
UniProt: P49897
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.