DIRAS3, Recombinant, Human, aa1-229, GST-Tag (GTP-binding Protein Di-Ras3)

Product Overview

• Article Name: DIRAS3, Recombinant, Human, aa1-229, GST-Tag (GTP-binding Protein Di-Ras3)
• Biozol Catalog Number: USB-373059
• Supplier Catalog Number: 373059
• Alternative Catalog Number: USB-373059-20,USB-373059-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-229 from human DIRAS3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.5kD Amino Acid Sequence: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 52.5
• UniProt: O95661
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.