DNA-binding Protein 7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-Tag (Sso7d)
Biozol Catalog Number:
USB-373076
Supplier Catalog Number:
373076
Alternative Catalog Number:
USB-373076-20,USB-373076-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Constrain negative DNA supercoils, may be involved in maintaining the integrity of their genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Source: Recombinant protein corresponding to aa2-64 from sulfolobus solfataricus sso7d, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.1kD Amino Acid Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted