DNA-binding Protein 7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-Tag (Sso7d)

Product Overview

• Article Name: DNA-binding Protein 7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-Tag (Sso7d)
• Biozol Catalog Number: USB-373076
• Supplier Catalog Number: 373076
• Alternative Catalog Number: USB-373076-20,USB-373076-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Constrain negative DNA supercoils, may be involved in maintaining the integrity of their genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Source: Recombinant protein corresponding to aa2-64 from sulfolobus solfataricus sso7d, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.1kD Amino Acid Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 9.1
• UniProt: P39476
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.