DNAJB1, Recombinant, Human, aa1-340, GST-Tag (DnaJ Homolog Subfamily B Member 1)

Product Overview

• Article Name: DNAJB1, Recombinant, Human, aa1-340, GST-Tag (DnaJ Homolog Subfamily B Member 1)
• Biozol Catalog Number: USB-373078
• Supplier Catalog Number: 373078
• Alternative Catalog Number: USB-373078-20,USB-373078-100,USB-373078-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Source: Recombinant protein corresponding to aa1-340 from human DNAJB1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~65kD Amino Acid Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 65
• UniProt: P25685
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.