DOG1, Recombinant, Saccharomyces Cerevisiae, aa1-246, His-Tag (2-deoxyglucose-6-phosphate Phosphatase 1)

Catalog Number: USB-373090
Article Name: DOG1, Recombinant, Saccharomyces Cerevisiae, aa1-246, His-Tag (2-deoxyglucose-6-phosphate Phosphatase 1)
Biozol Catalog Number: USB-373090
Supplier Catalog Number: 373090
Alternative Catalog Number: USB-373090-20,USB-373090-100
Manufacturer: US Biological
Category: Molekularbiologie
Active on 2-DOG-6P, also very active on fructose-1P. Source: Recombinant protein corresponding to aa1-246 from saccharomyces cerevisiae full length DOG1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.1kD Amino Acid Sequence: MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.1
UniProt: P38774
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.