DTWD1, Recombinant, Human, aa1-109, GST-Tag (DTW Domain-containing Protein 1)

Catalog Number: USB-373105
Article Name: DTWD1, Recombinant, Human, aa1-109, GST-Tag (DTW Domain-containing Protein 1)
Biozol Catalog Number: USB-373105
Supplier Catalog Number: 373105
Alternative Catalog Number: USB-373105-20,USB-373105-100,USB-373105-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-109 from human DTWD1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.2kD Amino Acid Sequence: MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.2
UniProt: Q8N5C7
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.