DUSP22, Recombinant, Human, aa1-184, GST-Tag (Dual Specificity Protein Phosphatase 22)

Product Overview

• Article Name: DUSP22, Recombinant, Human, aa1-184, GST-Tag (Dual Specificity Protein Phosphatase 22)
• Biozol Catalog Number: USB-373109
• Supplier Catalog Number: 373109
• Alternative Catalog Number: USB-373109-20,USB-373109-100,USB-373109-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK). Source: Recombinant protein corresponding to aa1-184 from human DUSP22, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.8kD Amino Acid Sequence: GNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 47.8
• UniProt: Q9NRW4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.