E2, Recombinant, Human, aa1-365, His-Tag (Papillomavirus Type 18 Regulatory Protein E2)

Catalog Number: USB-373118
Article Name: E2, Recombinant, Human, aa1-365, His-Tag (Papillomavirus Type 18 Regulatory Protein E2)
Biozol Catalog Number: USB-373118
Supplier Catalog Number: 373118
Alternative Catalog Number: USB-373118-20,USB-373118-100
Manufacturer: US Biological
Category: Molekularbiologie
E2 regulates viral transcription and DNA replication. It binds to the E2RE response element (5-ACCNNNNNNGGT-3) present in multiple copies in the regulatory region. It can either activate or repress transcription depending on E2REs position with regards to proximal promoter elements. Repression occurs by sterically hindering the assembly of the transcription initiation complex. The E1-E2 complex binds to the origin of DNA replication. Source: Recombinant protein corresponding to aa1-365 from human Papillomavirus Type 18 Regulatory Protein E2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~43.3kD Amino Acid Sequence: MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTYGQTSAATRPGHCGLAEKQHCGPVNPLLGAATPTGNNKRRKLCSGNTTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 43.3
UniProt: P06790
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.