Protein E7, Recombinant, Human Papillomavirus Type 16, aa1-98, His-Tag (E7)
Biozol Catalog Number:
USB-373122
Supplier Catalog Number:
373122
Alternative Catalog Number:
USB-373122-20,USB-373122-100,USB-373122-1
Manufacturer:
US Biological
Category:
Molekularbiologie
E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription. Recombinant protein corresponding to aa1-98 from full length human Papillomavirus Type 16 Protein E7, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P03129 Molecular Weight: ~15kD Amino Acid Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
