EEF1E1, Recombinant, Human, aa2-174, His-SUMO-Tag (Eukaryotic Translation Elongation Factor 1 Epsilon-1)

Catalog Number: USB-373130
Article Name: EEF1E1, Recombinant, Human, aa2-174, His-SUMO-Tag (Eukaryotic Translation Elongation Factor 1 Epsilon-1)
Biozol Catalog Number: USB-373130
Supplier Catalog Number: 373130
Alternative Catalog Number: USB-373130-20,USB-373130-100,USB-373130-1
Manufacturer: US Biological
Category: Molekularbiologie
Positive modulator of ATM response to DNA damage. Source: Recombinant protein corresponding to aa2-174 from human EEF1E1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.7kD Amino Acid Sequence: AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.7
UniProt: O43324
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.